PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462937657
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family NAC
Protein Properties Length: 339aa    MW: 37664.4 Da    PI: 6.1029
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462937657genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.42.3e-5231301128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                lppGfrFhPtd+elv +yLk+kv++ k+el evi+ +d+yk+ePw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat +gyWkatgkd+++ + +g 
  462937657   3 LPPGFRFHPTDDELVGYYLKRKVDNLKIEL-EVIPVIDLYKSEPWELPeKsFLPKRDLEWFFFCPRDRKYPNGSRTNRATVTGYWKATGKDRRIAC-DGG 100
                79****************************.99**************95334445667**************************************.999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                + g++ktLvfy+grap ge+tdWvmheyrl
  462937657 101 VYGVRKTLVFYRGRAPGGERTDWVMHEYRL 130
                9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-602152IPR003441NAC domain
PROSITE profilePS5100557.013153IPR003441NAC domain
PfamPF023651.1E-284130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MTLPPGFRFH PTDDELVGYY LKRKVDNLKI ELEVIPVIDL YKSEPWELPE KSFLPKRDLE  60
WFFFCPRDRK YPNGSRTNRA TVTGYWKATG KDRRIACDGG VYGVRKTLVF YRGRAPGGER  120
TDWVMHEYRL CQDLAHGASN FIGAYALCRV IKRHEAGLLQ GEPKAKAAGG ARAPMSKVPS  180
NSSLGSIDQL STFTSANSGS PPLDMSRGMC TVTESCNNFQ NSLAYGGDLC DMTATTNGIM  240
PPAPPLFAPT HSSHQMYAPP PEDMFFIGDA AESRPHDAPF FDMGSVSEHE LKWDDLTYGS  300
NAFPTTTTTT GADMLCRQAS DGVDDLAAFY FPDENRFVF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B7e-52115715169NAC domain-containing protein 19
4dul_A7e-52115715169NAC domain-containing protein 19
1ut7_B7e-52115715169NO APICAL MERISTEM PROTEIN
1ut7_A7e-52115715169NO APICAL MERISTEM PROTEIN
1ut4_B7e-52115715169NO APICAL MERISTEM PROTEIN
1ut4_A7e-52115715169NO APICAL MERISTEM PROTEIN
3swp_D7e-52115718172NAC domain-containing protein 19
3swp_C7e-52115718172NAC domain-containing protein 19
3swp_B7e-52115718172NAC domain-containing protein 19
3swp_A7e-52115718172NAC domain-containing protein 19
3swm_D7e-52115718172NAC domain-containing protein 19
3swm_C7e-52115718172NAC domain-containing protein 19
3swm_B7e-52115718172NAC domain-containing protein 19
3swm_A7e-52115718172NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008658556.11e-136PREDICTED: NAC domain-containing protein 67-like
SwissprotA4VCM01e-70NAC45_ARATH; NAC domain-containing protein 45
TrEMBLA0A096R9061e-136A0A096R906_MAIZE; Uncharacterized protein
STRINGGRMZM2G082709_P011e-136(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.13e-81NAC domain containing protein 71